PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0015s0133.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family G2-like
Protein Properties Length: 427aa    MW: 47600.4 Da    PI: 7.9575
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0015s0133.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.94.1e-32244297255
              G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Kalax.0015s0133.1.p 244 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 297
                          9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.87E-15241297IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-28242297IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-23244297IPR006447Myb domain, plants
PfamPF002497.7E-7245296IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 427 aa     Download sequence    Send to blast
MELFPAQQPD LSLQISPPNT TKPRPPWPRR PSSPEGHQHN SMELQGFLKR ALDNNNSSTM  60
AAAAATAKPN NKSNNNNNTK SSSDHYSDIL SLSNPRSIDN PFEPPHSHHH LLNHNPFHHY  120
SQSNTQNQHP TPHLHQAAAS FLGHHEQLSF LKPIRGIPIY QSPNFIASNT DFLHNQQQQH  180
HLQHSVLDSL SYLPSASETR TNTSCFMNNK INEGSINPCS NNNSLMSSSR FLSRFPGKRS  240
LRAPRMRWTS TLHARFVHAV ELLGGHERAT PKSVLELMDV KDLTLAHVKS HLQMYRTVKT  300
TDRAAASSNA YENGSSGDNS EDLMLDITNS IRNGDHQTSG GKTSATNQDR DNYHGLWSYS  360
SSREAWLHGR PTDSLVGNNI HLIEEMDPKS SSYNERLGEI SSLSEGYSTS NTLKPNLEFT  420
LGRSDC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012075102.11e-107PREDICTED: probable transcription factor KAN2 isoform X2
TrEMBLA0A067KUB81e-107A0A067KUB8_JATCU; Uncharacterized protein
STRINGVIT_02s0012g01940.t013e-92(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.14e-61G2-like family protein